SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5j58a1 (5j58 A:238-606)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105373Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2105374Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2106026Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2106027Protein automated matches [190459] (46 species)
    not a true protein
  7. 2106228Species Trypanosoma brucei [TaxId:999953] [226467] (26 PDB entries)
  8. 2285661Domain d5j58a1: 5j58 A:238-606 [328962]
    Other proteins in same PDB: d5j58a2, d5j58b2, d5j58b3
    automated match to d4eg8b1
    protein/RNA complex; complexed with dms, gol, met, n56

Details for d5j58a1

PDB Entry: 5j58 (more details), 2.8 Å

PDB Description: trypanosoma brucei methionyl-trna synthetase in complex with inhibitor (chem 1856)
PDB Compounds: (A:) Methionyl-tRNA synthetase, putative

SCOPe Domain Sequences for d5j58a1:

Sequence, based on SEQRES records: (download)

>d5j58a1 c.26.1.0 (A:238-606) automated matches {Trypanosoma brucei [TaxId: 999953]}
vekvffvtspiyyvnaaphighvystlitdvigryhrvkgervfaltgtdehgqkvaeaa
kqkqvspydfttavagefkkcfeqmdysidyfirttneqhkavvkelwtkleqkgdiylg
ryegwysisdesfltpqnitdgvdkdgnpckvslesghvvtwvseenymfrlsafrerll
ewyhanpgcivpefrrreviravekglpdlsvsraratlhnwaipvpgnpdhcvyvwlda
ltnyltgsrlrvdesgkevslvddfnelerfpadvhvigkdilkfhaiywpafllsaglp
lpkkivahgwwtkdrkkiskslgnvfdpvekaeefgydalkyfllresgfsddgdysdkn
miarlngel

Sequence, based on observed residues (ATOM records): (download)

>d5j58a1 c.26.1.0 (A:238-606) automated matches {Trypanosoma brucei [TaxId: 999953]}
vekvffvtspiyyvnaaphighvystlitdvigryhrvkgervfaltgtdehgqkvaeaa
kqkqvspydfttavagefkkcfeqmdysidyfirttneqhkavvkelwtkleqkgdiylg
ryegwysisdesfltpqnitdgvdkdgnpckvslesghvvtwvseenymfrlsafrerll
ewyhanpgcivpefrrreviravekglpdlsvsraratlhnwaipvpgnpdhcvyvwlda
ltnyltgsrlrvdesgkevslvddfnelerfpadvhvigkdilkfhaiywpafllsaglp
lpkkivahgwwtkvfdpvekaeefgydalkyfllresgfsddgdysdknmiarlngel

SCOPe Domain Coordinates for d5j58a1:

Click to download the PDB-style file with coordinates for d5j58a1.
(The format of our PDB-style files is described here.)

Timeline for d5j58a1:

  • d5j58a1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-26