Lineage for d1gtie2 (1gti E:1-78)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 395822Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 395823Superfamily c.47.1: Thioredoxin-like [52833] (14 families) (S)
  5. 395996Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins)
  6. 396206Protein Class pi GST [81358] (3 species)
  7. 396291Species Mouse (Mus musculus) [TaxId:10090] [52866] (6 PDB entries)
  8. 396306Domain d1gtie2: 1gti E:1-78 [32896]
    Other proteins in same PDB: d1gtia1, d1gtib1, d1gtic1, d1gtid1, d1gtie1, d1gtif1

Details for d1gtie2

PDB Entry: 1gti (more details), 3 Å

PDB Description: modified glutathione s-transferase (pi) complexed with s (p- nitrobenzyl)glutathione

SCOP Domain Sequences for d1gtie2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gtie2 c.47.1.5 (E:1-78) Class pi GST {Mouse (Mus musculus)}
ppytivyfpvrgrceamrmlladqgqswkeevvtidtwmqgllkptclygqlpkfedgdl
tlyqsnailrhlgrslgl

SCOP Domain Coordinates for d1gtie2:

Click to download the PDB-style file with coordinates for d1gtie2.
(The format of our PDB-style files is described here.)

Timeline for d1gtie2: