Lineage for d5j59a2 (5j59 A:607-766)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1991849Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
    core: 4 helices; bundle; one loop crosses over one side of the bundle
  4. 1991850Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) (S)
  5. 1991903Family a.27.1.0: automated matches [227164] (1 protein)
    not a true family
  6. 1991904Protein automated matches [226872] (8 species)
    not a true protein
  7. 1991925Species Trypanosoma brucei [TaxId:999953] [226468] (26 PDB entries)
  8. 2285651Domain d5j59a2: 5j59 A:607-766 [328952]
    Other proteins in same PDB: d5j59a1, d5j59b1, d5j59b3
    automated match to d4eg8b2
    protein/RNA complex; complexed with gol, met, n93

Details for d5j59a2

PDB Entry: 5j59 (more details), 2.4 Å

PDB Description: trypanosoma brucei methionyl-trna synthetase in complex with inhibitor (chem 1893)
PDB Compounds: (A:) Methionyl-tRNA synthetase, putative

SCOPe Domain Sequences for d5j59a2:

Sequence, based on SEQRES records: (download)

>d5j59a2 a.27.1.0 (A:607-766) automated matches {Trypanosoma brucei [TaxId: 999953]}
adtlgnlvmrctsakinvngewpspaayteedesliqlikdlpgtadhyylipdiqkaii
avfdvlrainayvtdmapwklvktdperlrtvlyitlegvrvttlllspilprksvvifd
mlgvpevhrkgienfefgavppgtrlgpavegevlfskrs

Sequence, based on observed residues (ATOM records): (download)

>d5j59a2 a.27.1.0 (A:607-766) automated matches {Trypanosoma brucei [TaxId: 999953]}
adtlgnlvmrctsakinvngewpspaayteedesliqlikdlpgtadhyylipdiqkaii
avfdvlrainayvtdmapwklvktdperlrtvlyitlegvrvttlllspilprksvvifd
mlgvpevhrkgienfefgavppgtrlgpavevlfskrs

SCOPe Domain Coordinates for d5j59a2:

Click to download the PDB-style file with coordinates for d5j59a2.
(The format of our PDB-style files is described here.)

Timeline for d5j59a2:

  • d5j59a2 appears in periodic updates to SCOPe 2.06 starting on 2017-01-26