SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5hz5a_ (5hz5 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2062521Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2062522Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2063049Family b.60.1.2: Fatty acid binding protein-like [50847] (18 protein domains)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 2063194Protein Epidermal fatty acid binding protein [50854] (1 species)
  7. 2063195Species Human (Homo sapiens) [TaxId:9606] [50855] (5 PDB entries)
  8. 2285646Domain d5hz5a_: 5hz5 A: [328947]
    automated match to d4lkpa_
    complexed with 65x, dms, so4

Details for d5hz5a_

PDB Entry: 5hz5 (more details), 1.4 Å

PDB Description: fabp5 in complex with 6-chloro-4-phenyl-2-piperidin-1-yl-3-(1h- tetrazol-5-yl)-quinoline
PDB Compounds: (A:) fatty acid-binding protein, epidermal

SCOPe Domain Sequences for d5hz5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hz5a_ b.60.1.2 (A:) Epidermal fatty acid binding protein {Human (Homo sapiens) [TaxId: 9606]}
atvqqlegrwrlvdskgfdeymkelgvgialrkmgamakpdciitcdgknltiktestlk
ttqfsctlgekfeettadgrktqtvcnftdgalvqhqewdgkestitrklkdgklvvecv
mnnvtctriyekve

SCOPe Domain Coordinates for d5hz5a_:

Click to download the PDB-style file with coordinates for d5hz5a_.
(The format of our PDB-style files is described here.)

Timeline for d5hz5a_:

  • d5hz5a_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-26