Class b: All beta proteins [48724] (180 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins) ten-stranded meander beta-sheet folded upon itself relates to the common fold by opening the barrel and insertion of beta-hairpin |
Protein Epidermal fatty acid binding protein [50854] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [50855] (6 PDB entries) |
Domain d5hz5a_: 5hz5 A: [328947] automated match to d4lkpa_ complexed with 65x, dms, so4 |
PDB Entry: 5hz5 (more details), 1.4 Å
SCOPe Domain Sequences for d5hz5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hz5a_ b.60.1.2 (A:) Epidermal fatty acid binding protein {Human (Homo sapiens) [TaxId: 9606]} atvqqlegrwrlvdskgfdeymkelgvgialrkmgamakpdciitcdgknltiktestlk ttqfsctlgekfeettadgrktqtvcnftdgalvqhqewdgkestitrklkdgklvvecv mnnvtctriyekve
Timeline for d5hz5a_: