Lineage for d5hz5a_ (5hz5 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2804862Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 2805069Protein Epidermal fatty acid binding protein [50854] (1 species)
  7. 2805070Species Human (Homo sapiens) [TaxId:9606] [50855] (6 PDB entries)
  8. 2805071Domain d5hz5a_: 5hz5 A: [328947]
    automated match to d4lkpa_
    complexed with 65x, dms, so4

Details for d5hz5a_

PDB Entry: 5hz5 (more details), 1.4 Å

PDB Description: fabp5 in complex with 6-chloro-4-phenyl-2-piperidin-1-yl-3-(1h- tetrazol-5-yl)-quinoline
PDB Compounds: (A:) fatty acid-binding protein, epidermal

SCOPe Domain Sequences for d5hz5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hz5a_ b.60.1.2 (A:) Epidermal fatty acid binding protein {Human (Homo sapiens) [TaxId: 9606]}
atvqqlegrwrlvdskgfdeymkelgvgialrkmgamakpdciitcdgknltiktestlk
ttqfsctlgekfeettadgrktqtvcnftdgalvqhqewdgkestitrklkdgklvvecv
mnnvtctriyekve

SCOPe Domain Coordinates for d5hz5a_:

Click to download the PDB-style file with coordinates for d5hz5a_.
(The format of our PDB-style files is described here.)

Timeline for d5hz5a_: