SCOPe 2.06: Domain d5hiya_: 5hiy A:

Lineage for d5hiya_ (5hiy A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.140: Replicase NSP9 [101815] (1 superfamily)
   barrel; n=6, S=8, greek-key; similar to one trypsin-like protease barrel

4. Superfamily b.140.1: Replicase NSP9 [101816] (2 families)

5. Family b.140.1.0: automated matches [191526] (1 protein)
   not a true family

6. Protein automated matches [190886] (3 species)
   not a true protein

7. Species Porcine epidemic diarrhea virus cv777 [TaxId:229032] [328880] (2 PDB entries)

8. Domain d5hiya_: 5hiy A: [328944]
   automated match to d1qz8a_
   mutant

Details for d5hiya_

PDB Entry: 5hiy, 3 Å

PDB Description: crystal structure of pedv nsp9 mutant-c59a

PDB Compounds: (A:) Non-structural protein 9

SCOPe Domain Sequences for d5hiya_:

Sequence, based on SEQRES records:

>d5hiya_ b.140.1.0 (A:) automated matches {Porcine epidemic diarrhea virus cv777 [TaxId: 229032]}
gklkqrsikaegdgivgegkalynneggrtfmyafisdkpdlrvvkwefdggantielep
prkflvdspngaqikylyfvrnlntlrrgavlgyigatv

Sequence, based on observed residues (ATOM records):

>d5hiya_ b.140.1.0 (A:) automated matches {Porcine epidemic diarrhea virus cv777 [TaxId: 229032]}
gklkqrsikaegdgivgegkalynneggrtfmyafisdkpdlrvvkweantielepprkf
lvdspngaqikylyfvrnlntlrrgavlgyigatv

Timeline for d5hiya_:

• d5hiya_ is new in SCOPe 2.06-stable
  
• d5hiya_ appears in SCOPe 2.07
  
• d5hiya_ appears in the current release, SCOPe 2.08