SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5huof1 (5huo F:5-116)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2168779Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 2168899Superfamily d.41.2: Nicotinate/Quinolinate PRTase N-terminal domain-like [54675] (3 families) (S)
  5. 2168971Family d.41.2.0: automated matches [227168] (1 protein)
    not a true family
  6. 2168972Protein automated matches [226878] (8 species)
    not a true protein
  7. 2285555Species Streptococcus pyogenes [TaxId:1115816] [328856] (1 PDB entry)
  8. 2285638Domain d5huof1: 5huo F:5-116 [328939]
    Other proteins in same PDB: d5huoa2, d5huob2, d5huoc2, d5huoe2, d5huof2, d5huoh2
    automated match to d1x1oa1
    complexed with so4; mutant

Details for d5huof1

PDB Entry: 5huo (more details), 2.8 Å

PDB Description: crystal structure of nadc deletion mutant in c2221 space group
PDB Compounds: (F:) Nicotinate-nucleotide diphosphorylase (Carboxylating)

SCOPe Domain Sequences for d5huof1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5huof1 d.41.2.0 (F:5-116) automated matches {Streptococcus pyogenes [TaxId: 1115816]}
stdltpfqiddtlkaalredvhsedystnaifdhhgqakvslfakeagvlagltvfqrvf
tlfdevtfqnphqfkdgdrltsgdlvleiigsvrslltcervalnflqhlsg

SCOPe Domain Coordinates for d5huof1:

Click to download the PDB-style file with coordinates for d5huof1.
(The format of our PDB-style files is described here.)

Timeline for d5huof1:

  • d5huof1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-26