SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5fucc1 (5fuc C:98-195)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2029371Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2029372Family b.1.2.1: Fibronectin type III [49266] (45 protein domains)
    Pfam PF00041
  6. 2029834Protein automated matches [190888] (1 species)
    not a true protein
  7. 2029835Species Human (Homo sapiens) [TaxId:9606] [188282] (30 PDB entries)
  8. 2285634Domain d5fucc1: 5fuc C:98-195 [328935]
    Other proteins in same PDB: d5fuca1, d5fuca2, d5fucb_, d5fuce_, d5fucv_
    automated match to d1n26a2
    complexed with nag

Details for d5fucc1

PDB Entry: 5fuc (more details), 2.7 Å

PDB Description: biophysical and cellular characterisation of a junctional epitope antibody that locks il-6 and gp80 together in a stable complex: implications for new therapeutic strategies
PDB Compounds: (C:) interleukin-6 receptor subunit alpha, interleukin-6 receptor

SCOPe Domain Sequences for d5fucc1:

Sequence, based on SEQRES records: (download)

>d5fucc1 b.1.2.1 (C:98-195) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pqlscfrksplsnvvcewgprstpslttkavllvrkfqnspaedfqepcqysqesqkfsc
qlavpegdssfyivsmcvassvgskfsktqtfqgagil

Sequence, based on observed residues (ATOM records): (download)

>d5fucc1 b.1.2.1 (C:98-195) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pqlscfrksplsnvvcewgprstpslttkavllvrkfqnsaedfqepcqysqesqkfscq
lavpegdssfyivsmcvassvgskfsktqtfqgagil

SCOPe Domain Coordinates for d5fucc1:

Click to download the PDB-style file with coordinates for d5fucc1.
(The format of our PDB-style files is described here.)

Timeline for d5fucc1:

  • d5fucc1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-26