SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5hqlc2 (5hql C:139-456)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2088460Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 2088461Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 protein domains)
    N-terminal domain is alpha+beta
  6. 2088660Protein automated matches [226984] (9 species)
    not a true protein
  7. 2285583Species Rhodopseudomonas palustris [TaxId:1] [328884] (1 PDB entry)
  8. 2285633Domain d5hqlc2: 5hql C:139-456 [328934]
    Other proteins in same PDB: d5hqla1, d5hqlb1, d5hqlc1, d5hqld1, d5hqle1, d5hqlf1
    automated match to d4lf2a2
    complexed with cap, mg; mutant

Details for d5hqlc2

PDB Entry: 5hql (more details), 2.53 Å

PDB Description: structure function studies of r. palustris rubisco (a47v-m331a mutant; cabp-bound; no expression tag)
PDB Compounds: (C:) Ribulose bisphosphate carboxylase

SCOPe Domain Sequences for d5hqlc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hqlc2 c.1.14.1 (C:139-456) automated matches {Rhodopseudomonas palustris [TaxId: 1]}
gpsttikdlwrvlgrpvinggfivgtiikpklglrpqpfanacydfwlggdfikndepqg
nqvfapfkdtvravadamrraqdktgeaklfsfnitaddhyemlargefiletfadnadh
iaflvdgyvagpaavttarrafpkqylhyhraghgavtspqskrgytafvlskmarlqga
sgihtgtmgfgkaegeaadraiaymitedaadgpyfhqewlgmnpttpiisggmnalrmp
gffdnlghsnlimtagggafghvdggaagakslrqaeqcwkqgadpvefakdhrefaraf
esfpqdadklypnwrakl

SCOPe Domain Coordinates for d5hqlc2:

Click to download the PDB-style file with coordinates for d5hqlc2.
(The format of our PDB-style files is described here.)

Timeline for d5hqlc2:

  • d5hqlc2 appears in periodic updates to SCOPe 2.06 starting on 2017-01-26