Class a: All alpha proteins [46456] (289 folds) |
Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily) core: 4 helices; bundle; one loop crosses over one side of the bundle |
Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) |
Family a.27.1.0: automated matches [227164] (1 protein) not a true family |
Protein automated matches [226872] (13 species) not a true protein |
Species Trypanosoma brucei [TaxId:999953] [226468] (29 PDB entries) |
Domain d5j5ab2: 5j5a B:607-767 [328928] Other proteins in same PDB: d5j5aa1, d5j5ab1, d5j5ab3 automated match to d4eg8b2 protein/RNA complex; complexed with 756, met |
PDB Entry: 5j5a (more details), 2.7 Å
SCOPe Domain Sequences for d5j5ab2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5j5ab2 a.27.1.0 (B:607-767) automated matches {Trypanosoma brucei [TaxId: 999953]} adtlgnlvmrctsakinvngewpspaayteedesliqlikdlpgtadhyylipdiqkaii avfdvlrainayvtdmapwklvktdperlrtvlyitlegvrvttlllspilprksvvifd mlgvpevhrkgienfefgavppgtrlgpavegevlfskrst
Timeline for d5j5ab2: