Lineage for d5hjfc_ (5hjf C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703895Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2703896Protein automated matches [190036] (60 species)
    not a true protein
  7. 2704499Species Nostoc punctiforme [TaxId:272131] [328838] (3 PDB entries)
  8. 2704502Domain d5hjfc_: 5hjf C: [328926]
    Other proteins in same PDB: d5hjfd2
    automated match to d4cyba_

Details for d5hjfc_

PDB Entry: 5hjf (more details), 1.59 Å

PDB Description: the apo form of dps4 from nostoc punctiforme
PDB Compounds: (C:) Ferritin, Dps family protein

SCOPe Domain Sequences for d5hjfc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hjfc_ a.25.1.0 (C:) automated matches {Nostoc punctiforme [TaxId: 272131]}
tqtllrnfgnvydnpvlldrsvtapvtegfnvvlasfqalylqyqkhhfvvegsefyslh
effnesynqvqdhiheigerldglggvpvatfsklaeltcfeqesegvyssrqmvendla
aeqaiigvirrqaaqaeslgdrgtrylyekillkteerayhlshflakdsltlgfvqaa

SCOPe Domain Coordinates for d5hjfc_:

Click to download the PDB-style file with coordinates for d5hjfc_.
(The format of our PDB-style files is described here.)

Timeline for d5hjfc_: