SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5j71a2 (5j71 A:187-392)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2190933Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2190934Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2191440Family d.122.1.4: alpha-ketoacid dehydrogenase kinase, C-terminal domain [69804] (3 protein domains)
  6. 2191459Protein automated matches [230554] (2 species)
    not a true protein
  7. 2191460Species Human (Homo sapiens) [TaxId:9606] [230555] (14 PDB entries)
  8. 2285623Domain d5j71a2: 5j71 A:187-392 [328924]
    Other proteins in same PDB: d5j71a1
    automated match to d1y8oa3
    complexed with p35, tla

Details for d5j71a2

PDB Entry: 5j71 (more details), 1.65 Å

PDB Description: crystal structure of pyruvate dehydrogenase kinase isoform 2 in complex with inhibitor ps35
PDB Compounds: (A:) [pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 2, mitochondrial

SCOPe Domain Sequences for d5j71a2:

Sequence, based on SEQRES records: (download)

>d5j71a2 d.122.1.4 (A:187-392) automated matches {Human (Homo sapiens) [TaxId: 9606]}
higsidpncnvsevvkdaydmakllcdkyymaspdleiqeinaanskqpihmvyvpshly
hmlfelfknamratveshesslilppikvmvalgeedlsikmsdrgggvplrkierlfsy
mystaptpqpgtggtplagfgyglpisrlyakyfqgdlqlfsmegfgtdaviylkalstd
sverlpvynksawrhyqtiqeagdwc

Sequence, based on observed residues (ATOM records): (download)

>d5j71a2 d.122.1.4 (A:187-392) automated matches {Human (Homo sapiens) [TaxId: 9606]}
higsidpncnvsevvkdaydmakllcdkyymaspdleiqeinaansqpihmvyvpshlyh
mlfelfknamratveshesslilppikvmvalgeedlsikmsdrgggvplrkierlfsym
gyglpisrlyakyfqgdlqlfsmegfgtdaviylkalstdsverlpvynksawrhydwc

SCOPe Domain Coordinates for d5j71a2:

Click to download the PDB-style file with coordinates for d5j71a2.
(The format of our PDB-style files is described here.)

Timeline for d5j71a2:

  • d5j71a2 appears in periodic updates to SCOPe 2.06 starting on 2017-01-26

View in 3D
Domains from same chain:
(mouse over for more information)
d5j71a1