Lineage for d5j71a1 (5j71 A:12-176)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1992366Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1993175Superfamily a.29.5: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69012] (2 families) (S)
    automatically mapped to Pfam PF10436
  5. 1993176Family a.29.5.1: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69013] (3 protein domains)
  6. 1993195Protein automated matches [230549] (2 species)
    not a true protein
  7. 1993196Species Human (Homo sapiens) [TaxId:9606] [230552] (19 PDB entries)
  8. 2285622Domain d5j71a1: 5j71 A:12-176 [328923]
    Other proteins in same PDB: d5j71a2
    automated match to d1y8pa1
    complexed with p35, tla

Details for d5j71a1

PDB Entry: 5j71 (more details), 1.65 Å

PDB Description: crystal structure of pyruvate dehydrogenase kinase isoform 2 in complex with inhibitor ps35
PDB Compounds: (A:) [pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 2, mitochondrial

SCOPe Domain Sequences for d5j71a1:

Sequence, based on SEQRES records: (download)

>d5j71a1 a.29.5.1 (A:12-176) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slagapkyiehfskfspsplsmkqfldfgssnacektsftflrqelpvrlanimkeinll
pdrvlstpsvqlvqswyvqslldimefldkdpedhrtlsqftdalvtirnrhndvvptma
qgvleykdtygddpvsnqniqyfldrfylsrisirmlinqhtlif

Sequence, based on observed residues (ATOM records): (download)

>d5j71a1 a.29.5.1 (A:12-176) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slagapkyiehfskfspsplsmkqfldcektsftflrqelpvrlanimkeinllpdrvls
tpsvqlvqswyvqslldimefldkdpedhrtlsqftdalvtirnrhndvvptmaqgvley
kdtygddpvsnqniqyfldrfylsrisirmlinqhtlif

SCOPe Domain Coordinates for d5j71a1:

Click to download the PDB-style file with coordinates for d5j71a1.
(The format of our PDB-style files is described here.)

Timeline for d5j71a1:

  • d5j71a1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-26

View in 3D
Domains from same chain:
(mouse over for more information)
d5j71a2