SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5jiwa_ (5jiw A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2081497Family c.1.8.1: Amylase, catalytic domain [51446] (26 protein domains)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2081989Protein automated matches [190099] (25 species)
    not a true protein
  7. 2285620Species Thermus aquaticus [TaxId:271] [328921] (1 PDB entry)
  8. 2285621Domain d5jiwa_: 5jiw A: [328922]
    automated match to d1fp8a_
    complexed with bgc, co3, edo, glc

Details for d5jiwa_

PDB Entry: 5jiw (more details), 1.73 Å

PDB Description: crystal structure of thermus aquaticus amylomaltase (gh77) in complex with a 34-meric cycloamylose
PDB Compounds: (A:) 4-alpha-glucanotransferase

SCOPe Domain Sequences for d5jiwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jiwa_ c.1.8.1 (A:) automated matches {Thermus aquaticus [TaxId: 271]}
melprafglllhptslpgpygvgvlgreardflrflkeaggrywqvlplgptgygdspyq
sfsafagnpylidlrplaergyvrledpgfpqgrvdygllyawkwpalkeafrgfkekas
peereafaafrereawwledyalfmalkgahgglpwnrwplplrkreekalreaksalae
evafhaftqwlffrqwgalkaeaealgiriigdmpifvaedsaevwahpewfhldeegrp
tvvagvppdyfsetgqrwgnplyrwdvleregfsfwirrlekalelfhlvriahfrgfea
yweipascptavegrwvkapgeklfqkiqevfgevpvlaedlgvitpevealrdrfglpg
mkvlqfafdxgmenpflphnypahgrvvvytgthnndttlgwyrtatphekafmarylad
wgitfreeeevpwalmhlgmksvarlavypvqdvlalgsearmnypgrpsgnwawrllpg
elspehgarlramaeaterl

SCOPe Domain Coordinates for d5jiwa_:

Click to download the PDB-style file with coordinates for d5jiwa_.
(The format of our PDB-style files is described here.)

Timeline for d5jiwa_:

  • d5jiwa_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-26