Lineage for d5hulb1 (5hul B:5-116)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2168779Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 2168899Superfamily d.41.2: Nicotinate/Quinolinate PRTase N-terminal domain-like [54675] (3 families) (S)
  5. 2168971Family d.41.2.0: automated matches [227168] (1 protein)
    not a true family
  6. 2168972Protein automated matches [226878] (8 species)
    not a true protein
  7. 2285560Species Streptococcus pyogenes [TaxId:471876] [328861] (1 PDB entry)
  8. 2285618Domain d5hulb1: 5hul B:5-116 [328919]
    Other proteins in same PDB: d5hula2, d5hulb2, d5hulc2, d5huld2
    automated match to d1x1oa1
    complexed with po4; mutant

Details for d5hulb1

PDB Entry: 5hul (more details), 2.86 Å

PDB Description: crystal structure of nadc deletion mutant in cubic space group
PDB Compounds: (B:) quinolinate phosphoribosyltransferase

SCOPe Domain Sequences for d5hulb1:

Sequence, based on SEQRES records: (download)

>d5hulb1 d.41.2.0 (B:5-116) automated matches {Streptococcus pyogenes [TaxId: 471876]}
stdltpfqiddtlkaalredvhsedystnaifdhhgqakvslfakeagvlagltvfqrvf
tlfdevtfqnphqfkdgdrltsgdlvleiigsvrslltcervalnflqhlsg

Sequence, based on observed residues (ATOM records): (download)

>d5hulb1 d.41.2.0 (B:5-116) automated matches {Streptococcus pyogenes [TaxId: 471876]}
stdltpfqiddtlkaalredvhsedystnaifdhgqakvslfakeagvlagltvfqrvft
lfdevtfqnphqfkdgdrltsgdlvleiigsvrslltcervalnflqhlsg

SCOPe Domain Coordinates for d5hulb1:

Click to download the PDB-style file with coordinates for d5hulb1.
(The format of our PDB-style files is described here.)

Timeline for d5hulb1:

  • d5hulb1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-26