Lineage for d5hqma2 (5hqm A:139-461)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2088460Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 2088461Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 protein domains)
    N-terminal domain is alpha+beta
  6. 2088660Protein automated matches [226984] (9 species)
    not a true protein
  7. 2285613Species Rhodospirillum rubrum [TaxId:1085] [328914] (1 PDB entry)
  8. 2285614Domain d5hqma2: 5hqm A:139-461 [328915]
    Other proteins in same PDB: d5hqma1, d5hqmb1
    automated match to d4lf2a2
    complexed with cap, k, mg

Details for d5hqma2

PDB Entry: 5hqm (more details), 1.95 Å

PDB Description: structure function studies of r. palustris rubisco (r. palustris/r. rubrum chimera)
PDB Compounds: (A:) Ribulose bisphosphate carboxylase (R. palustris/R. rubrum chimera),Ribulose bisphosphate carboxylase

SCOPe Domain Sequences for d5hqma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hqma2 c.1.14.1 (A:139-461) automated matches {Rhodospirillum rubrum [TaxId: 1085]}
gpsttikdlwrvlgrpvinggfivgtiikpklglrpqpfanacydfwlggdfikndepqg
nqvfapfkdtvravadamrraqdktgeaklfsfnitaddhyemlargefiletfadnadh
iaflvdgyvagpaavttarrafpkqylhyhraghgavtspqskrgytafvlskmarlqga
sgihtgtmgfgkmegeaadraiaymitedaadgpyfhqewlgmnpttpiisggmnalrmp
gffdnlghsnlimtagggafghvdggaagakslrqaeqcwkqgadpvefakdhrefaraf
esfpqdadklypnwraklgvedt

SCOPe Domain Coordinates for d5hqma2:

Click to download the PDB-style file with coordinates for d5hqma2.
(The format of our PDB-style files is described here.)

Timeline for d5hqma2:

  • d5hqma2 appears in periodic updates to SCOPe 2.06 starting on 2017-01-26

View in 3D
Domains from same chain:
(mouse over for more information)
d5hqma1