![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.17: Nicotinate/Quinolinate PRTase C-terminal domain-like [51690] (3 families) ![]() incomplete beta/alpha barrel with parallel beta-sheet of 7 strands |
![]() | Family c.1.17.0: automated matches [227169] (1 protein) not a true family |
![]() | Protein automated matches [226879] (8 species) not a true protein |
![]() | Species Streptococcus pyogenes [TaxId:471876] [328863] (1 PDB entry) |
![]() | Domain d5hulc2: 5hul C:117-288 [328910] Other proteins in same PDB: d5hula1, d5hulb1, d5hulc1, d5huld1 automated match to d1x1oa2 complexed with po4; mutant |
PDB Entry: 5hul (more details), 2.86 Å
SCOPe Domain Sequences for d5hulc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hulc2 c.1.17.0 (C:117-288) automated matches {Streptococcus pyogenes [TaxId: 471876]} iasmtaayvealgddrikvfdtrkttpnlrlfekyavrvgggynhrfnlsdaimlkdnhi aavgsvqkaiaqarayapfvkmveveveslaaaeeaaaagvdiimldnmsleqieqaitl iagrsriecsgnidmttisrfrglaidyvssgslthsaksldfsmkgltyld
Timeline for d5hulc2: