SCOPe 2.06: Domain d5hulc1: 5hul C:6-116

Lineage for d5hulc1 (5hul C:6-116)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
   core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids

4. Superfamily d.41.2: Nicotinate/Quinolinate PRTase N-terminal domain-like [54675] (3 families)

5. Family d.41.2.0: automated matches [227168] (1 protein)
   not a true family

6. Protein automated matches [226878] (8 species)
   not a true protein

7. Species Streptococcus pyogenes [TaxId:471876] [328861] (1 PDB entry)

8. Domain d5hulc1: 5hul C:6-116 [328909]
   Other proteins in same PDB: d5hula2, d5hulb2, d5hulc2, d5huld2
   automated match to d1x1oa1
   complexed with po4; mutant

Details for d5hulc1

PDB Entry: 5hul, 2.86 Å

PDB Description: crystal structure of nadc deletion mutant in cubic space group

PDB Compounds: (C:) quinolinate phosphoribosyltransferase

SCOPe Domain Sequences for d5hulc1:

Sequence; same for both SEQRES and ATOM records:

>d5hulc1 d.41.2.0 (C:6-116) automated matches {Streptococcus pyogenes [TaxId: 471876]}
tdltpfqiddtlkaalredvhsedystnaifdhhgqakvslfakeagvlagltvfqrvft
lfdevtfqnphqfkdgdrltsgdlvleiigsvrslltcervalnflqhlsg

Timeline for d5hulc1:

• d5hulc1 is new in SCOPe 2.06-stable
  
• d5hulc1 appears in SCOPe 2.07
  
• d5hulc1 appears in the current release, SCOPe 2.08