SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5hpqa_ (5hpq A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2145531Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2145532Protein automated matches [190039] (136 species)
    not a true protein
  7. 2146113Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [196922] (6 PDB entries)
  8. 2285607Domain d5hpqa_: 5hpq A: [328908]
    automated match to d3kbra_
    complexed with act

Details for d5hpqa_

PDB Entry: 5hpq (more details), 2.05 Å

PDB Description: crystal structure of cyclohexadienyl dehydratase from pseudomonas aeruginosa bound to acetate
PDB Compounds: (A:) Cyclohexadienyl dehydratase

SCOPe Domain Sequences for d5hpqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hpqa_ c.94.1.0 (A:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
esrldrilesgvlrvattgdykpfsyrteeggyagfdvdmaqrlaeslgaklvvvptswp
nlmrdfaddrfdiamsgisinlerqrqayfsipylrdgktpitlcseearfqtleqidqp
gvtaivnpggtnekfaranlkkarilvhpdnvtifqqivdgkadlmmtdaiearlqsrlh
pelcavhpqqpfdfaekayllprdeafkryvdqwlhiaeqsgllrqrmehwleyrwpt

SCOPe Domain Coordinates for d5hpqa_:

Click to download the PDB-style file with coordinates for d5hpqa_.
(The format of our PDB-style files is described here.)

Timeline for d5hpqa_:

  • d5hpqa_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-25