Lineage for d5hpqa_ (5hpq A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2145531Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2145532Protein automated matches [190039] (138 species)
    not a true protein
  7. 2146113Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [196922] (6 PDB entries)
  8. 2285607Domain d5hpqa_: 5hpq A: [328908]
    automated match to d3kbra_
    complexed with act

Details for d5hpqa_

PDB Entry: 5hpq (more details), 2.05 Å

PDB Description: crystal structure of cyclohexadienyl dehydratase from pseudomonas aeruginosa bound to acetate
PDB Compounds: (A:) Cyclohexadienyl dehydratase

SCOPe Domain Sequences for d5hpqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hpqa_ c.94.1.0 (A:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
esrldrilesgvlrvattgdykpfsyrteeggyagfdvdmaqrlaeslgaklvvvptswp
nlmrdfaddrfdiamsgisinlerqrqayfsipylrdgktpitlcseearfqtleqidqp
gvtaivnpggtnekfaranlkkarilvhpdnvtifqqivdgkadlmmtdaiearlqsrlh
pelcavhpqqpfdfaekayllprdeafkryvdqwlhiaeqsgllrqrmehwleyrwpt

SCOPe Domain Coordinates for d5hpqa_:

Click to download the PDB-style file with coordinates for d5hpqa_.
(The format of our PDB-style files is described here.)

Timeline for d5hpqa_:

  • d5hpqa_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-25