SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5j58b2 (5j58 B:607-767)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1991849Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
    core: 4 helices; bundle; one loop crosses over one side of the bundle
  4. 1991850Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) (S)
  5. 1991903Family a.27.1.0: automated matches [227164] (1 protein)
    not a true family
  6. 1991904Protein automated matches [226872] (8 species)
    not a true protein
  7. 1991925Species Trypanosoma brucei [TaxId:999953] [226468] (24 PDB entries)
  8. 2285605Domain d5j58b2: 5j58 B:607-767 [328906]
    Other proteins in same PDB: d5j58a1, d5j58b1, d5j58b3
    automated match to d4eg8b2
    protein/RNA complex; complexed with dms, gol, met, n56

Details for d5j58b2

PDB Entry: 5j58 (more details), 2.8 Å

PDB Description: trypanosoma brucei methionyl-trna synthetase in complex with inhibitor (chem 1856)
PDB Compounds: (B:) Methionyl-tRNA synthetase, putative

SCOPe Domain Sequences for d5j58b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j58b2 a.27.1.0 (B:607-767) automated matches {Trypanosoma brucei [TaxId: 999953]}
adtlgnlvmrctsakinvngewpspaayteedesliqlikdlpgtadhyylipdiqkaii
avfdvlrainayvtdmapwklvktdperlrtvlyitlegvrvttlllspilprksvvifd
mlgvpevhrkgienfefgavppgtrlgpavegevlfskrst

SCOPe Domain Coordinates for d5j58b2:

Click to download the PDB-style file with coordinates for d5j58b2.
(The format of our PDB-style files is described here.)

Timeline for d5j58b2:

  • d5j58b2 appears in periodic updates to SCOPe 2.06 starting on 2017-01-26