Lineage for d5hosa_ (5hos A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083716Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2083717Protein automated matches [190075] (89 species)
    not a true protein
  7. 2084319Species Xanthomonas axonopodis [TaxId:190486] [260217] (12 PDB entries)
  8. 2285603Domain d5hosa_: 5hos A: [328904]
    automated match to d1gzja_
    complexed with so4

Details for d5hosa_

PDB Entry: 5hos (more details), 1.6 Å

PDB Description: crystal structure of the endo-beta-1,4-glucanase xac0029 from xanthomonas axonopodis pv. citri
PDB Compounds: (A:) cellulase

SCOPe Domain Sequences for d5hosa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hosa_ c.1.8.0 (A:) automated matches {Xanthomonas axonopodis [TaxId: 190486]}
lkyagvnlsgaeikssqkpgvlnidyrypaadeyayfagkhmntvrlpilwerlqpragg
eldpaqlalirqavanakaakmyvivdvhnyakyyghtigstkvpistfndlwrrlaiaf
ksdnavifglmnepydidpqawataaqasidtirktgatnlilvpgalwtgahswystva
gqsnavamasirdplnryaieahqyldadssgtsggcvsatvgverlrsftewlrlnkkr
gflaefgtgntvtcnlalngmlgymesnsdvwmgwswwaagawwsgaypfnvqpdaqgrd
kpqmsilsprarritd

SCOPe Domain Coordinates for d5hosa_:

Click to download the PDB-style file with coordinates for d5hosa_.
(The format of our PDB-style files is described here.)

Timeline for d5hosa_:

  • d5hosa_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-25