SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5hosa_ (5hos A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083716Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2083717Protein automated matches [190075] (87 species)
    not a true protein
  7. 2084319Species Xanthomonas axonopodis [TaxId:190486] [260217] (12 PDB entries)
  8. 2285603Domain d5hosa_: 5hos A: [328904]
    automated match to d1gzja_
    complexed with so4

Details for d5hosa_

PDB Entry: 5hos (more details), 1.6 Å

PDB Description: crystal structure of the endo-beta-1,4-glucanase xac0029 from xanthomonas axonopodis pv. citri
PDB Compounds: (A:) cellulase

SCOPe Domain Sequences for d5hosa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hosa_ c.1.8.0 (A:) automated matches {Xanthomonas axonopodis [TaxId: 190486]}
lkyagvnlsgaeikssqkpgvlnidyrypaadeyayfagkhmntvrlpilwerlqpragg
eldpaqlalirqavanakaakmyvivdvhnyakyyghtigstkvpistfndlwrrlaiaf
ksdnavifglmnepydidpqawataaqasidtirktgatnlilvpgalwtgahswystva
gqsnavamasirdplnryaieahqyldadssgtsggcvsatvgverlrsftewlrlnkkr
gflaefgtgntvtcnlalngmlgymesnsdvwmgwswwaagawwsgaypfnvqpdaqgrd
kpqmsilsprarritd

SCOPe Domain Coordinates for d5hosa_:

Click to download the PDB-style file with coordinates for d5hosa_.
(The format of our PDB-style files is described here.)

Timeline for d5hosa_:

  • d5hosa_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-25