Lineage for d5hpca1 (5hpc A:2-316)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083716Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2083717Protein automated matches [190075] (90 species)
    not a true protein
  7. 2084319Species Xanthomonas axonopodis [TaxId:190486] [260217] (12 PDB entries)
  8. 2285600Domain d5hpca1: 5hpc A:2-316 [328901]
    Other proteins in same PDB: d5hpca2
    automated match to d1gzja_

Details for d5hpca1

PDB Entry: 5hpc (more details), 2.6 Å

PDB Description: structure of xaccel5a crystallized in the space group p41212
PDB Compounds: (A:) cellulase

SCOPe Domain Sequences for d5hpca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hpca1 c.1.8.0 (A:2-316) automated matches {Xanthomonas axonopodis [TaxId: 190486]}
lkyvgvnlsgaefnsrkkpgtlfkdytypaasdfsyfagkgmntirlpflwervqpelng
pldqaqlglikksleaakankqylildlhnyatysgkrigtsdvpagaladlwrrlapef
kddkavifglmnepngisapdwanaaqgtitairktgaknlilvpgtaytgahswrstsy
gvsnakaleilkdpgnnlafeahqyldkdysgtkpvctsdsvgqeklqgftswlrenkqk
gflgefatannpvcdkalegmltymeknsdvwlgwtwwaagawwkpdypftvqpgkdgsd
kpqmailskyarrag

SCOPe Domain Coordinates for d5hpca1:

Click to download the PDB-style file with coordinates for d5hpca1.
(The format of our PDB-style files is described here.)

Timeline for d5hpca1:

  • d5hpca1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-25

View in 3D
Domains from same chain:
(mouse over for more information)
d5hpca2