SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5hpca1 (5hpc A:2-316)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083716Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2083717Protein automated matches [190075] (87 species)
    not a true protein
  7. 2084319Species Xanthomonas axonopodis [TaxId:190486] [260217] (12 PDB entries)
  8. 2285600Domain d5hpca1: 5hpc A:2-316 [328901]
    Other proteins in same PDB: d5hpca2
    automated match to d1gzja_

Details for d5hpca1

PDB Entry: 5hpc (more details), 2.6 Å

PDB Description: structure of xaccel5a crystallized in the space group p41212
PDB Compounds: (A:) cellulase

SCOPe Domain Sequences for d5hpca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hpca1 c.1.8.0 (A:2-316) automated matches {Xanthomonas axonopodis [TaxId: 190486]}
lkyvgvnlsgaefnsrkkpgtlfkdytypaasdfsyfagkgmntirlpflwervqpelng
pldqaqlglikksleaakankqylildlhnyatysgkrigtsdvpagaladlwrrlapef
kddkavifglmnepngisapdwanaaqgtitairktgaknlilvpgtaytgahswrstsy
gvsnakaleilkdpgnnlafeahqyldkdysgtkpvctsdsvgqeklqgftswlrenkqk
gflgefatannpvcdkalegmltymeknsdvwlgwtwwaagawwkpdypftvqpgkdgsd
kpqmailskyarrag

SCOPe Domain Coordinates for d5hpca1:

Click to download the PDB-style file with coordinates for d5hpca1.
(The format of our PDB-style files is described here.)

Timeline for d5hpca1:

  • d5hpca1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-25

View in 3D
Domains from same chain:
(mouse over for more information)
d5hpca2