Lineage for d5fccb_ (5fcc B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2814471Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2815203Family b.82.1.0: automated matches [191354] (1 protein)
    not a true family
  6. 2815204Protein automated matches [190388] (30 species)
    not a true protein
  7. 2815301Species Pseudomonas fluorescens [TaxId:216595] [189073] (2 PDB entries)
  8. 2815305Domain d5fccb_: 5fcc B: [328893]
    automated match to d3esgb_
    complexed with cl, edo, na

Details for d5fccb_

PDB Entry: 5fcc (more details), 1.94 Å

PDB Description: structure of hutd from pseudomonas fluorescens sbw25 (nacl condition)
PDB Compounds: (B:) HutD

SCOPe Domain Sequences for d5fccb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fccb_ b.82.1.0 (B:) automated matches {Pseudomonas fluorescens [TaxId: 216595]}
saisvwravdyvrmpwkngggsteeitrdagtglegfgwrlsiadigesggfssfagyqr
vitviqgagmvltvdgeeqrgllplqpfafrgdsqvscrlitgpirdfnliysperyhar
lqwvdgvqrffstaqtvlvfsvadevkvlgeklghhdclqvdgnaglldisvtgrcclie
ltqrg

SCOPe Domain Coordinates for d5fccb_:

Click to download the PDB-style file with coordinates for d5fccb_.
(The format of our PDB-style files is described here.)

Timeline for d5fccb_: