SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5fccb_ (5fcc B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2070014Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2070015Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2070601Family b.82.1.0: automated matches [191354] (1 protein)
    not a true family
  6. 2070602Protein automated matches [190388] (21 species)
    not a true protein
  7. 2070661Species Pseudomonas fluorescens [TaxId:216595] [189073] (3 PDB entries)
  8. 2285592Domain d5fccb_: 5fcc B: [328893]
    automated match to d3esgb_
    complexed with cl, edo, na

Details for d5fccb_

PDB Entry: 5fcc (more details), 1.94 Å

PDB Description: structure of hutd from pseudomonas fluorescens sbw25 (nacl condition)
PDB Compounds: (B:) HutD

SCOPe Domain Sequences for d5fccb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fccb_ b.82.1.0 (B:) automated matches {Pseudomonas fluorescens [TaxId: 216595]}
saisvwravdyvrmpwkngggsteeitrdagtglegfgwrlsiadigesggfssfagyqr
vitviqgagmvltvdgeeqrgllplqpfafrgdsqvscrlitgpirdfnliysperyhar
lqwvdgvqrffstaqtvlvfsvadevkvlgeklghhdclqvdgnaglldisvtgrcclie
ltqrg

SCOPe Domain Coordinates for d5fccb_:

Click to download the PDB-style file with coordinates for d5fccb_.
(The format of our PDB-style files is described here.)

Timeline for d5fccb_:

  • d5fccb_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-25