SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5hnnc1 (5hnn C:2-317)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083716Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2083717Protein automated matches [190075] (87 species)
    not a true protein
  7. 2084319Species Xanthomonas axonopodis [TaxId:190486] [260217] (12 PDB entries)
  8. 2285591Domain d5hnnc1: 5hnn C:2-317 [328892]
    Other proteins in same PDB: d5hnna2, d5hnnc2
    automated match to d1gzja_
    complexed with gol; mutant

Details for d5hnnc1

PDB Entry: 5hnn (more details), 1.63 Å

PDB Description: crystal structure of the endo-beta-1,4-glucanase (xac0030) from xanthomonas axonopodis pv. citri with the triple mutation his174trp, tyr211ala and lys227arg.
PDB Compounds: (C:) cellulase

SCOPe Domain Sequences for d5hnnc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hnnc1 c.1.8.0 (C:2-317) automated matches {Xanthomonas axonopodis [TaxId: 190486]}
lkyvgvnlsgaefnsrkkpgtlfkdytypaasdfsyfagkgmntirlpflwervqpelng
pldqaqlglikksleaakankqylildlhnyatysgkrigtsdvpagaladlwrrlalef
kddkavifglmnepngisapdwanaaqgtitairktgaknlilvpgtaytgawswrstsy
gvsnakaleilkdpgnnlafeahqyldkdasgtkpvctsdsvgqerlqgftswlrenkqk
gflgefatannpvcdkalegmltymeknsdvwlgwtwwaagawwkpdypftvqpgkdgsd
kpqmailskyarragk

SCOPe Domain Coordinates for d5hnnc1:

Click to download the PDB-style file with coordinates for d5hnnc1.
(The format of our PDB-style files is described here.)

Timeline for d5hnnc1:

  • d5hnnc1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-26