Lineage for d2glrb2 (2glr B:1-78)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 180865Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
  4. 180866Superfamily c.47.1: Thioredoxin-like [52833] (12 families) (S)
  5. 181002Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (4 proteins)
  6. 181014Protein Glutathione S-transferase [52863] (27 species)
  7. 181201Species Mouse (Mus musculus), class pi [TaxId:10090] [52866] (6 PDB entries)
  8. 181209Domain d2glrb2: 2glr B:1-78 [32889]
    Other proteins in same PDB: d2glra1, d2glrb1

Details for d2glrb2

PDB Entry: 2glr (more details), 2.2 Å

PDB Description: molecular structure at 1.8 angstroms of mouse liver class pi glutathione s-transferase complexed with s-(p-nitrobenzyl)glutathione and other inhibitors

SCOP Domain Sequences for d2glrb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2glrb2 c.47.1.5 (B:1-78) Glutathione S-transferase {Mouse (Mus musculus), class pi}
ppytivyfpvrgrceamrmlladqgqswkeevvtidtwmqgllkptclygqlpkfedgdl
tlyqsnailrhlgrslgl

SCOP Domain Coordinates for d2glrb2:

Click to download the PDB-style file with coordinates for d2glrb2.
(The format of our PDB-style files is described here.)

Timeline for d2glrb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2glrb1