Lineage for d5huja_ (5huj A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105373Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2106293Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 2106294Family c.26.2.1: N-type ATP pyrophosphatases [52403] (9 protein domains)
  6. 2106421Protein automated matches [190257] (4 species)
    not a true protein
  7. 2285553Species Streptococcus pyogenes [TaxId:471876] [328854] (2 PDB entries)
  8. 2285586Domain d5huja_: 5huj A: [328887]
    automated match to d3hmqa_
    complexed with cl

Details for d5huja_

PDB Entry: 5huj (more details), 2.1 Å

PDB Description: crystal structure of nade from streptococcus pyogenes
PDB Compounds: (A:) nh(3)-dependent nad(+) synthetase

SCOPe Domain Sequences for d5huja_:

Sequence, based on SEQRES records: (download)

>d5huja_ c.26.2.1 (A:) automated matches {Streptococcus pyogenes [TaxId: 471876]}
mtlqeeiirqlgvkasidpqeeirktvdflkaylrkhsflktyvlgisggqdstlagkla
qmaiaelreetsdqayqfiavrlpygvqadeadaqkalafiapdqtltinikaavdgqve
alqaagveisdfnkgnikarqrmisqyaiagqmagavigtdhaaenitgfftkfgdggad
ilplfrlnkrqgkallkvlgadaalyekvptadledqkpgladevalgvtyqdiddyleg
kliskvaqatiekwwhkgqhkrhlpitifadfwk

Sequence, based on observed residues (ATOM records): (download)

>d5huja_ c.26.2.1 (A:) automated matches {Streptococcus pyogenes [TaxId: 471876]}
mtlqeeiirqlgvkasidpqeeirktvdflkaylrkhsflktyvlgisggqdstlagkla
qmaiaelreetsdqayqfiavrlpygvqdeadaqkalafiapdqtltinikaavdgqvea
lqaagveisdfnkgnikarqrmisqyaiagqmagavigtdhaaenitgfftkfgdggadi
lplfrlnkrqgkallkvlgadaalyeladevalgvtyqdiddylegkliskvaqatiekw
whkgqhkrhlpitifadfwk

SCOPe Domain Coordinates for d5huja_:

Click to download the PDB-style file with coordinates for d5huja_.
(The format of our PDB-style files is described here.)

Timeline for d5huja_:

  • d5huja_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-25