SCOPe 2.06: Domain d5hqle1: 5hql E:1-138

Lineage for d5hqle1 (5hql E:1-138)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families)
   C-terminal domain is beta/alpha barrel

5. Family d.58.9.0: automated matches [227234] (1 protein)
   not a true family

6. Protein automated matches [226983] (18 species)
   not a true protein

7. Species Rhodopseudomonas palustris [TaxId:1] [328882] (1 PDB entry)

8. Domain d5hqle1: 5hql E:1-138 [328883]
   Other proteins in same PDB: d5hqla2, d5hqlb2, d5hqlc2, d5hqld2, d5hqle2, d5hqlf2
   automated match to d4lf2a1
   complexed with cap, mg; mutant

Details for d5hqle1

PDB Entry: 5hql, 2.53 Å

PDB Description: structure function studies of r. palustris rubisco (a47v-m331a mutant; cabp-bound; no expression tag)

PDB Compounds: (E:) Ribulose bisphosphate carboxylase

SCOPe Domain Sequences for d5hqle1:

Sequence; same for both SEQRES and ATOM records:

>d5hqle1 d.58.9.0 (E:1-138) automated matches {Rhodopseudomonas palustris [TaxId: 1]}
mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfvaesstgtnvevst
tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve
yakmydfyvppaylklfd

Timeline for d5hqle1:

• d5hqle1 is new in SCOPe 2.06-stable
  
• d5hqle1 appears in SCOPe 2.07
  
• d5hqle1 appears in the current release, SCOPe 2.08