Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) C-terminal domain is beta/alpha barrel |
Family d.58.9.0: automated matches [227234] (1 protein) not a true family |
Protein automated matches [226983] (18 species) not a true protein |
Species Rhodopseudomonas palustris [TaxId:1] [328882] (1 PDB entry) |
Domain d5hqle1: 5hql E:1-138 [328883] Other proteins in same PDB: d5hqla2, d5hqlb2, d5hqlc2, d5hqld2, d5hqle2, d5hqlf2 automated match to d4lf2a1 complexed with cap, mg; mutant |
PDB Entry: 5hql (more details), 2.53 Å
SCOPe Domain Sequences for d5hqle1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hqle1 d.58.9.0 (E:1-138) automated matches {Rhodopseudomonas palustris [TaxId: 1]} mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfvaesstgtnvevst tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve yakmydfyvppaylklfd
Timeline for d5hqle1: