SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5hgxa1 (5hgx A:2-334)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2108258Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2108259Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2108851Family c.36.1.0: automated matches [227300] (1 protein)
    not a true family
  6. 2108852Protein automated matches [227126] (18 species)
    not a true protein
  7. 2285547Species Scheffersomyces stipitis [TaxId:322104] [328848] (7 PDB entries)
  8. 2285576Domain d5hgxa1: 5hgx A:2-334 [328877]
    Other proteins in same PDB: d5hgxa3
    automated match to d1ay0a1
    complexed with 1pe; mutant

Details for d5hgxa1

PDB Entry: 5hgx (more details), 1.09 Å

PDB Description: crystal structure of transketolase mutant - h261f from pichia stipitis
PDB Compounds: (A:) transketolase

SCOPe Domain Sequences for d5hgxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hgxa1 c.36.1.0 (A:2-334) automated matches {Scheffersomyces stipitis [TaxId: 322104]}
ssvdqkaistirllavdavaaansghpgaplglapaahavfkkmrfnpkdtkwinrdrfv
lsnghacallysmlvlygydltvedlkkfrqlgsktpghpentdvpgaevttgplgqgic
ngvgialaqaqfaatynkpdfpisdsytyvflgdgclmegvsseasslaghlqlgnliaf
wddnkisidgstevaftedviaryksygwhivevsdadtditaiaaaideakkvtnkptl
vrltttigfgslaqgthgvfgaplkaddikqlktkwgfnpeesfavpaevtasynehvae
nqkiqqqwnelfaaykqkypelgaelqrrldgk

SCOPe Domain Coordinates for d5hgxa1:

Click to download the PDB-style file with coordinates for d5hgxa1.
(The format of our PDB-style files is described here.)

Timeline for d5hgxa1:

  • d5hgxa1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-25