SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5huld2 (5hul D:117-288)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089241Superfamily c.1.17: Nicotinate/Quinolinate PRTase C-terminal domain-like [51690] (3 families) (S)
    incomplete beta/alpha barrel with parallel beta-sheet of 7 strands
  5. 2089313Family c.1.17.0: automated matches [227169] (1 protein)
    not a true family
  6. 2089314Protein automated matches [226879] (8 species)
    not a true protein
  7. 2285562Species Streptococcus pyogenes [TaxId:471876] [328863] (1 PDB entry)
  8. 2285570Domain d5huld2: 5hul D:117-288 [328871]
    Other proteins in same PDB: d5hula1, d5hulb1, d5hulc1, d5huld1
    automated match to d1x1oa2
    complexed with po4; mutant

Details for d5huld2

PDB Entry: 5hul (more details), 2.86 Å

PDB Description: crystal structure of nadc deletion mutant in cubic space group
PDB Compounds: (D:) quinolinate phosphoribosyltransferase

SCOPe Domain Sequences for d5huld2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5huld2 c.1.17.0 (D:117-288) automated matches {Streptococcus pyogenes [TaxId: 471876]}
iasmtaayvealgddrikvfdtrkttpnlrlfekyavrvgggynhrfnlsdaimlkdnhi
aavgsvqkaiaqarayapfvkmveveveslaaaeeaaaagvdiimldnmsleqieqaitl
iagrsriecsgnidmttisrfrglaidyvssgslthsaksldfsmkgltyld

SCOPe Domain Coordinates for d5huld2:

Click to download the PDB-style file with coordinates for d5huld2.
(The format of our PDB-style files is described here.)

Timeline for d5huld2:

  • d5huld2 appears in periodic updates to SCOPe 2.06 starting on 2017-01-26