Lineage for d1bayb2 (1bay B:1-78)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2132062Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 2132391Protein Class pi GST [81358] (4 species)
  7. 2132525Species Mouse (Mus musculus) [TaxId:10090] [52866] (9 PDB entries)
  8. 2132533Domain d1bayb2: 1bay B:1-78 [32887]
    Other proteins in same PDB: d1baya1, d1bayb1

Details for d1bayb2

PDB Entry: 1bay (more details), 2 Å

PDB Description: glutathione s-transferase yfyf cys 47-carboxymethylated class pi, free enzyme
PDB Compounds: (B:) glutathione s-transferase class pi

SCOPe Domain Sequences for d1bayb2:

Sequence, based on SEQRES records: (download)

>d1bayb2 c.47.1.5 (B:1-78) Class pi GST {Mouse (Mus musculus) [TaxId: 10090]}
ppytivyfpvrgrceamrmlladqgqswkeevvtidtwmqgllkptclygqlpkfedgdl
tlyqsnailrhlgrslgl

Sequence, based on observed residues (ATOM records): (download)

>d1bayb2 c.47.1.5 (B:1-78) Class pi GST {Mouse (Mus musculus) [TaxId: 10090]}
ppytivyfpvrgrceamrmlladqgqswkeevvtiqlpkfedgdltlyqsnailrhlgrs
lgl

SCOPe Domain Coordinates for d1bayb2:

Click to download the PDB-style file with coordinates for d1bayb2.
(The format of our PDB-style files is described here.)

Timeline for d1bayb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bayb1