SCOP 1.67: Domain d1bayb2: 1bay B:1-78

Lineage for d1bayb2 (1bay B:1-78)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (14 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins)

6. Protein Class pi GST [81358] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [52866] (6 PDB entries)

8. Domain d1bayb2: 1bay B:1-78 [32887]
   Other proteins in same PDB: d1baya1, d1bayb1

Details for d1bayb2

PDB Entry: 1bay, 2 Å

PDB Description: glutathione s-transferase yfyf cys 47-carboxymethylated class pi, free enzyme

SCOP Domain Sequences for d1bayb2:

Sequence, based on SEQRES records:

>d1bayb2 c.47.1.5 (B:1-78) Class pi GST {Mouse (Mus musculus)}
ppytivyfpvrgrceamrmlladqgqswkeevvtidtwmqglkptclygqlpkfedgdlt
lyqsnailrhlgrslgl

Sequence, based on observed residues (ATOM records):

>d1bayb2 c.47.1.5 (B:1-78) Class pi GST {Mouse (Mus musculus)}
ppytivyfpvrgrceamrmlladqgqswkeevvtiqlpkfedgdltlyqsnailrhlgrs
lgl

Timeline for d1bayb2:

• d1bayb2 first appeared (with stable ids) in SCOP 1.55
  
• d1bayb2 appears in SCOP 1.65
  
• d1bayb2 appears in SCOP 1.69
  
• d1bayb2 appears in the current release, SCOPe 2.08