Lineage for d1bayb2 (1bay B:1-78)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 24115Fold c.47: Thioredoxin fold [52832] (3 superfamilies)
  4. 24116Superfamily c.47.1: Thioredoxin-like [52833] (10 families) (S)
  5. 24235Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (2 proteins)
  6. 24236Protein Glutathione S-transferase [52863] (22 species)
  7. 24405Species Mouse (Mus musculus), class pi [TaxId:10090] [52866] (6 PDB entries)
  8. 24411Domain d1bayb2: 1bay B:1-78 [32887]
    Other proteins in same PDB: d1baya1, d1bayb1

Details for d1bayb2

PDB Entry: 1bay (more details), 2 Å

PDB Description: glutathione s-transferase yfyf cys 47-carboxymethylated class pi, free enzyme

SCOP Domain Sequences for d1bayb2:

Sequence, based on SEQRES records: (download)

>d1bayb2 c.47.1.5 (B:1-78) Glutathione S-transferase {Mouse (Mus musculus), class pi}
ppytivyfpvrgrceamrmlladqgqswkeevvtidtwmqglkptclygqlpkfedgdlt
lyqsnailrhlgrslgl

Sequence, based on observed residues (ATOM records): (download)

>d1bayb2 c.47.1.5 (B:1-78) Glutathione S-transferase {Mouse (Mus musculus), class pi}
ppytivyfpvrgrceamrmlladqgqswkeevvtiqlpkfedgdltlyqsnailrhlgrs
lgl

SCOP Domain Coordinates for d1bayb2:

Click to download the PDB-style file with coordinates for d1bayb2.
(The format of our PDB-style files is described here.)

Timeline for d1bayb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bayb1