SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5fuca1 (5fuc A:21-184)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1991436Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 1991437Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 1991438Family a.26.1.1: Long-chain cytokines [47267] (10 protein domains)
  6. 1991516Protein automated matches [190263] (1 species)
    not a true protein
  7. 1991517Species Human (Homo sapiens) [TaxId:9606] [187052] (11 PDB entries)
  8. 2285567Domain d5fuca1: 5fuc A:21-184 [328868]
    Other proteins in same PDB: d5fuca2, d5fucc1, d5fucc2, d5fucd1, d5fucd2, d5fuce_, d5fucv_
    automated match to d4cnic_
    complexed with nag

Details for d5fuca1

PDB Entry: 5fuc (more details), 2.7 Å

PDB Description: biophysical and cellular characterisation of a junctional epitope antibody that locks il-6 and gp80 together in a stable complex: implications for new therapeutic strategies
PDB Compounds: (A:) interleukin-6

SCOPe Domain Sequences for d5fuca1:

Sequence, based on SEQRES records: (download)

>d5fuca1 a.26.1.1 (A:21-184) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sseridkqiryildgisalrketcnksnmcesskealaennlnlpkmaekdgcfqsgfne
etclvkiitgllefevyleylqnrfesseeqaravqmstkvliqflqkkaknldaittpd
pttnaslltklqaqnqwlqdmtthlilrsfkeflqsslralrqm

Sequence, based on observed residues (ATOM records): (download)

>d5fuca1 a.26.1.1 (A:21-184) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sseridkqiryildgisalrketcnksnmcenlpkmaekdgcfqsgfneetclvkiitgl
lefevyleylqnrfesseeqaravqmstkvliqflqkkadaittpdpttnaslltklqaq
nqwlqdmtthlilrsfkeflqsslralrqm

SCOPe Domain Coordinates for d5fuca1:

Click to download the PDB-style file with coordinates for d5fuca1.
(The format of our PDB-style files is described here.)

Timeline for d5fuca1:

  • d5fuca1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-25