SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5hnva1 (5hnv A:11-293)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2195565Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2195566Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2199100Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2199101Protein automated matches [190417] (25 species)
    not a true protein
  7. 2285564Species Serratia sp. [TaxId:1327989] [328865] (1 PDB entry)
  8. 2285565Domain d5hnva1: 5hnv A:11-293 [328866]
    Other proteins in same PDB: d5hnva2
    automated match to d1o6ya_
    complexed with atp, gol, mg

Details for d5hnva1

PDB Entry: 5hnv (more details), 1.41 Å

PDB Description: crystal structure of ppka
PDB Compounds: (A:) PpkA N terminal

SCOPe Domain Sequences for d5hnva1:

Sequence, based on SEQRES records: (download)

>d5hnva1 d.144.1.0 (A:11-293) automated matches {Serratia sp. [TaxId: 1327989]}
snslpsgyrfnefeiqeaigeggfgivyraydhqlertiaikeymptslakrnddlsigl
rgerfgktfqaglnsfiqearllarfshpgllhvlrfweengtaymgtqfysgttlknlq
aqqpekideawirrllpplfsaintihqegylhrdisldniqiqesqlpvlldfgsarke
ignlsdeteivlkpgfapieqytensdgeqgpwtdiyalgavlhtlivgspppvsvvrsi
edsyqplterrpagyspellrtvdralalkpedrpqtidemae

Sequence, based on observed residues (ATOM records): (download)

>d5hnva1 d.144.1.0 (A:11-293) automated matches {Serratia sp. [TaxId: 1327989]}
snslpsgyrfnefeiqeaigeggfgivyraydhqlertiaikeymptslakrnddlsigl
rgerfgktfqaglnsfiqearllarfshpgllhvlrfweengtaymgtqfysgttlknlq
aqqpekideawirrllpplfsaintihqegylhrdisldniqiqesqlpvlldfgsarke
ignlsdeteivlkpgfapieqyteqgpwtdiyalgavlhtlivgspppvsvvrsiedsyq
plterrpagyspellrtvdralalkpedrpqtidemae

SCOPe Domain Coordinates for d5hnva1:

Click to download the PDB-style file with coordinates for d5hnva1.
(The format of our PDB-style files is described here.)

Timeline for d5hnva1:

  • d5hnva1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-25

View in 3D
Domains from same chain:
(mouse over for more information)
d5hnva2