Lineage for d5hnva1 (5hnv A:11-293)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2195565Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2195566Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2199100Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2199101Protein automated matches [190417] (25 species)
    not a true protein
  7. 2285564Species Serratia sp. [TaxId:1327989] [328865] (1 PDB entry)
  8. 2285565Domain d5hnva1: 5hnv A:11-293 [328866]
    Other proteins in same PDB: d5hnva2
    automated match to d1o6ya_
    complexed with atp, gol, mg

Details for d5hnva1

PDB Entry: 5hnv (more details), 1.41 Å

PDB Description: crystal structure of ppka
PDB Compounds: (A:) PpkA N terminal

SCOPe Domain Sequences for d5hnva1:

Sequence, based on SEQRES records: (download)

>d5hnva1 d.144.1.0 (A:11-293) automated matches {Serratia sp. [TaxId: 1327989]}
snslpsgyrfnefeiqeaigeggfgivyraydhqlertiaikeymptslakrnddlsigl
rgerfgktfqaglnsfiqearllarfshpgllhvlrfweengtaymgtqfysgttlknlq
aqqpekideawirrllpplfsaintihqegylhrdisldniqiqesqlpvlldfgsarke
ignlsdeteivlkpgfapieqytensdgeqgpwtdiyalgavlhtlivgspppvsvvrsi
edsyqplterrpagyspellrtvdralalkpedrpqtidemae

Sequence, based on observed residues (ATOM records): (download)

>d5hnva1 d.144.1.0 (A:11-293) automated matches {Serratia sp. [TaxId: 1327989]}
snslpsgyrfnefeiqeaigeggfgivyraydhqlertiaikeymptslakrnddlsigl
rgerfgktfqaglnsfiqearllarfshpgllhvlrfweengtaymgtqfysgttlknlq
aqqpekideawirrllpplfsaintihqegylhrdisldniqiqesqlpvlldfgsarke
ignlsdeteivlkpgfapieqyteqgpwtdiyalgavlhtlivgspppvsvvrsiedsyq
plterrpagyspellrtvdralalkpedrpqtidemae

SCOPe Domain Coordinates for d5hnva1:

Click to download the PDB-style file with coordinates for d5hnva1.
(The format of our PDB-style files is described here.)

Timeline for d5hnva1:

  • d5hnva1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-25

View in 3D
Domains from same chain:
(mouse over for more information)
d5hnva2