SCOPe 2.08: Domain d5hula2: 5hul A:117-288

Lineage for d5hula2 (5hul A:117-288)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.17: Nicotinate/Quinolinate PRTase C-terminal domain-like [51690] (3 families)
   incomplete beta/alpha barrel with parallel beta-sheet of 7 strands

5. Family c.1.17.0: automated matches [227169] (1 protein)
   not a true family

6. Protein automated matches [226879] (8 species)
   not a true protein

7. Species Streptococcus pyogenes [TaxId:471876] [328863] (1 PDB entry)

8. Domain d5hula2: 5hul A:117-288 [328864]
   Other proteins in same PDB: d5hula1, d5hulb1, d5hulc1, d5huld1
   automated match to d1x1oa2
   complexed with po4; mutant

Details for d5hula2

PDB Entry: 5hul, 2.86 Å

PDB Description: crystal structure of nadc deletion mutant in cubic space group

PDB Compounds: (A:) quinolinate phosphoribosyltransferase

SCOPe Domain Sequences for d5hula2:

Sequence; same for both SEQRES and ATOM records:

>d5hula2 c.1.17.0 (A:117-288) automated matches {Streptococcus pyogenes [TaxId: 471876]}
iasmtaayvealgddrikvfdtrkttpnlrlfekyavrvgggynhrfnlsdaimlkdnhi
aavgsvqkaiaqarayapfvkmveveveslaaaeeaaaagvdiimldnmsleqieqaitl
iagrsriecsgnidmttisrfrglaidyvssgslthsaksldfsmkgltyld

Timeline for d5hula2:

• d5hula2 first appeared in SCOPe 2.06
  
• d5hula2 appears in SCOPe 2.07