Lineage for d5ghza_ (5ghz A:)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2217740Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2217741Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2217742Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 protein domains)
  6. 2218486Protein automated matches [190161] (23 species)
    not a true protein
  7. 2218489Species Bacillus licheniformis [TaxId:1402] [188244] (14 PDB entries)
  8. 2285559Domain d5ghza_: 5ghz A: [328860]
    automated match to d2blma_
    complexed with ced; mutant

Details for d5ghza_

PDB Entry: 5ghz (more details), 1.93 Å

PDB Description: crystal structure of beta-lactamase penp mutant-e166h in complex with cephaloridine as "pre-deacylation" intermediate
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d5ghza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ghza_ e.3.1.1 (A:) automated matches {Bacillus licheniformis [TaxId: 1402]}
ddfakleeqfdaklgifaldtgtnrtvayrpderfafastikaltvgvllqqksiedlnq
ritytrddlvnynpitekhvdtgmtlkeladaslrysdnaaqnlilkqiggpeslkkelr
kigdevtnperfhpelnevnpgetqdtstaralvtslrafaledklpsekrellidwmkr
nttgdaliragvpdgwevadktgaasygtrndiaiiwppkgdpvvlavlssrdkkdakyd
dkliaeatkvvmkaln

SCOPe Domain Coordinates for d5ghza_:

Click to download the PDB-style file with coordinates for d5ghza_.
(The format of our PDB-style files is described here.)

Timeline for d5ghza_:

  • d5ghza_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-25