SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5hjea3 (5hje A:532-677)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2120181Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. 2120182Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) (S)
  5. 2120348Family c.48.1.0: automated matches [227237] (1 protein)
    not a true family
  6. 2120349Protein automated matches [226991] (9 species)
    not a true protein
  7. 2285550Species Scheffersomyces stipitis [TaxId:322104] [328851] (7 PDB entries)
  8. 2285551Domain d5hjea3: 5hje A:532-677 [328852]
    Other proteins in same PDB: d5hjea1, d5hjea2
    automated match to d1gpua3
    complexed with ca, i22, tpp

Details for d5hjea3

PDB Entry: 5hje (more details), 1.4 Å

PDB Description: crystal structure of transketolase complex with sedoheptulose-7- phoaphate from pichia stipitis
PDB Compounds: (A:) transketolase

SCOPe Domain Sequences for d5hjea3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hjea3 c.48.1.0 (A:532-677) automated matches {Scheffersomyces stipitis [TaxId: 322104]}
egssiekaskggytlvqqdkadiiivatgsevslavdalkvlegqgikagvvslpdqltf
dkqseeyklsvlpdgvpilsvevmstfgwskyshqqfglnrfgasgkapeifklfeftpe
gvaeraaktvafykgkdvvsplrsaf

SCOPe Domain Coordinates for d5hjea3:

Click to download the PDB-style file with coordinates for d5hjea3.
(The format of our PDB-style files is described here.)

Timeline for d5hjea3:

  • d5hjea3 appears in periodic updates to SCOPe 2.06 starting on 2017-01-25