![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.48: TK C-terminal domain-like [52921] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest |
![]() | Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) ![]() |
![]() | Family c.48.1.0: automated matches [227237] (1 protein) not a true family |
![]() | Protein automated matches [226991] (9 species) not a true protein |
![]() | Species Scheffersomyces stipitis [TaxId:322104] [328851] (23 PDB entries) |
![]() | Domain d5hjea3: 5hje A:532-677 [328852] Other proteins in same PDB: d5hjea1, d5hjea2 automated match to d1gpua3 complexed with ca, i22, tpp |
PDB Entry: 5hje (more details), 1.4 Å
SCOPe Domain Sequences for d5hjea3:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hjea3 c.48.1.0 (A:532-677) automated matches {Scheffersomyces stipitis [TaxId: 322104]} egssiekaskggytlvqqdkadiiivatgsevslavdalkvlegqgikagvvslpdqltf dkqseeyklsvlpdgvpilsvevmstfgwskyshqqfglnrfgasgkapeifklfeftpe gvaeraaktvafykgkdvvsplrsaf
Timeline for d5hjea3: