SCOP 1.61: Domain d1glpb2: 1glp B:1-78

Lineage for d1glpb2 (1glp B:1-78)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)

4. Superfamily c.47.1: Thioredoxin-like [52833] (12 families)

5. Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (4 proteins)

6. Protein Glutathione S-transferase [52863] (27 species)

7. Species Mouse (Mus musculus), class pi [TaxId:10090] [52866] (6 PDB entries)

8. Domain d1glpb2: 1glp B:1-78 [32885]
   Other proteins in same PDB: d1glpa1, d1glpb1

Details for d1glpb2

PDB Entry: 1glp, 1.9 Å

PDB Description: 1.8 angstroms molecular structure of mouse liver class pi glutathione s-transferase complexed with s-(p-nitrobenzyl)glutathione and other inhibitors

SCOP Domain Sequences for d1glpb2:

Sequence; same for both SEQRES and ATOM records:

>d1glpb2 c.47.1.5 (B:1-78) Glutathione S-transferase {Mouse (Mus musculus), class pi}
ppytivyfpvrgrceamrmlladqgqswkeevvtidtwmqgllkptclygqlpkfedgdl
tlyqsnailrhlgrslgl

Timeline for d1glpb2:

• d1glpb2 first appeared (with stable ids) in SCOP 1.55
  
• d1glpb2 appears in SCOP 1.59
  
• d1glpb2 appears in SCOP 1.63
  
• d1glpb2 appears in the current release, SCOPe 2.08