Lineage for d1glpb2 (1glp B:1-78)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 24115Fold c.47: Thioredoxin fold [52832] (3 superfamilies)
  4. 24116Superfamily c.47.1: Thioredoxin-like [52833] (10 families) (S)
  5. 24235Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (2 proteins)
  6. 24236Protein Glutathione S-transferase [52863] (22 species)
  7. 24405Species Mouse (Mus musculus), class pi [TaxId:10090] [52866] (6 PDB entries)
  8. 24409Domain d1glpb2: 1glp B:1-78 [32885]
    Other proteins in same PDB: d1glpa1, d1glpb1

Details for d1glpb2

PDB Entry: 1glp (more details), 1.9 Å

PDB Description: 1.8 angstroms molecular structure of mouse liver class pi glutathione s-transferase complexed with s-(p-nitrobenzyl)glutathione and other inhibitors

SCOP Domain Sequences for d1glpb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1glpb2 c.47.1.5 (B:1-78) Glutathione S-transferase {Mouse (Mus musculus), class pi}
ppytivyfpvrgrceamrmlladqgqswkeevvtidtwmqgllkptclygqlpkfedgdl
tlyqsnailrhlgrslgl

SCOP Domain Coordinates for d1glpb2:

Click to download the PDB-style file with coordinates for d1glpb2.
(The format of our PDB-style files is described here.)

Timeline for d1glpb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1glpb1