SCOPe 2.06: Domain d5fyxa_: 5fyx A:

Lineage for d5fyxa_ (5fyx A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein automated matches [190064] (21 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [258881] (5 PDB entries)

8. Domain d5fyxa_: 5fyx A: [328843]
   automated match to d2lcpa_
   complexed with ca, fd6, mpd

Details for d5fyxa_

PDB Entry: 5fyx, 1.8 Å

PDB Description: crystal structure of drosophila ncs-1 bound to penothiazine fd16

PDB Compounds: (A:) frequenin 2

SCOPe Domain Sequences for d5fyxa_:

Sequence, based on SEQRES records:

>d5fyxa_ a.39.1.5 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
klkqdtidrlttdtyftekeirqwhkgflkdcpngllteqgfikiykqffpdgdpskfas
lvfrvfdenndgaiefeefiralsitsrgnldeklhwafrlydvdndgyitreemynivd
aiyqmvgqqpqtedentpqkrvdkifdqmdknhddrltleefregskadprmvqalslg

Sequence, based on observed residues (ATOM records):

>d5fyxa_ a.39.1.5 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
klkqdtidrlttdtyftekeirqwhkgflkdcpngllteqgfikiykqffpdgdpskfas
lvfrvfdenndgaiefeefiralsitsrgnldeklhwafrlydvdndgyitreemynivd
aiyqmvtpqkrvdkifdqmdknhddrltleefregskadprmvqalslg

Timeline for d5fyxa_:

• d5fyxa_ is new in SCOPe 2.06-stable
  
• d5fyxa_ appears in SCOPe 2.07
  
• d5fyxa_ appears in the current release, SCOPe 2.08