SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5hjfd1 (5hjf D:1-182)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1988413Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1988414Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1990537Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 1990538Protein automated matches [190036] (37 species)
    not a true protein
  7. 2285537Species Nostoc punctiforme [TaxId:272131] [328838] (3 PDB entries)
  8. 2285541Domain d5hjfd1: 5hjf D:1-182 [328842]
    Other proteins in same PDB: d5hjfd2
    automated match to d4cyba_

Details for d5hjfd1

PDB Entry: 5hjf (more details), 1.59 Å

PDB Description: the apo form of dps4 from nostoc punctiforme
PDB Compounds: (D:) Ferritin, Dps family protein

SCOPe Domain Sequences for d5hjfd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hjfd1 a.25.1.0 (D:1-182) automated matches {Nostoc punctiforme [TaxId: 272131]}
maetqtllrnfgnvydnpvlldrsvtapvtegfnvvlasfqalylqyqkhhfvvegsefy
slheffnesynqvqdhiheigerldglggvpvatfsklaeltcfeqesegvyssrqmven
dlaaeqaiigvirrqaaqaeslgdrgtrylyekillkteerayhlshflakdsltlgfvq
aa

SCOPe Domain Coordinates for d5hjfd1:

Click to download the PDB-style file with coordinates for d5hjfd1.
(The format of our PDB-style files is described here.)

Timeline for d5hjfd1:

  • d5hjfd1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-25