Lineage for d5aohb_ (5aoh B:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2208774Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2208775Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2209498Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2209499Protein automated matches [190159] (16 species)
    not a true protein
  7. 2285514Species Serratia sp. [TaxId:104623] [328815] (1 PDB entry)
  8. 2285540Domain d5aohb_: 5aoh B: [328841]
    automated match to d2q17e_
    complexed with k

Details for d5aohb_

PDB Entry: 5aoh (more details), 1.8 Å

PDB Description: crystal structure of carf
PDB Compounds: (B:) carf

SCOPe Domain Sequences for d5aohb_:

Sequence, based on SEQRES records: (download)

>d5aohb_ d.169.1.0 (B:) automated matches {Serratia sp. [TaxId: 104623]}
ilpidevnvdggdfyvglvfgkedyaahanthltpfsimrtevtyhqyqalqawaetrgy
qisggcngatfedcwpsekdggrhpvtnvswwdavifanalsaqhnlqpyyvtadgqalk
ippeegtdrgirenpqasgyrlptlaewqvaarggnkglsdgtygsryagkdqpasvanl
pvsgtqtfstlpvaskqpnslglydmsgnvsewlnenyavkggkkmyyfcggsymdrvgs
lascdvhtpgfamsdigfrlvrpid

Sequence, based on observed residues (ATOM records): (download)

>d5aohb_ d.169.1.0 (B:) automated matches {Serratia sp. [TaxId: 104623]}
ilpidevnvdggdfyvglvfgkedyaahanthltpfsimrtevtyhqyqalqawaetrgy
qisggcngatfedcwpsekdggrhpvtnvswwdavifanalsaqhnlqpyyvtadgqalk
ippeegirenpqasgyrlptlaewqvaarggnkglsdgtygsryagkdqpasvanlpvsg
tqtfstlpvaskqpnslglydmsgnvsewlnenyavkggkkmyyfcggsymdrvgslasc
dvhtpgfamsdigfrlvrpid

SCOPe Domain Coordinates for d5aohb_:

Click to download the PDB-style file with coordinates for d5aohb_.
(The format of our PDB-style files is described here.)

Timeline for d5aohb_:

  • d5aohb_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-25