SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5aohb_ (5aoh B:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2208774Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2208775Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2209498Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2209499Protein automated matches [190159] (15 species)
    not a true protein
  7. 2285514Species Serratia sp. [TaxId:104623] [328815] (1 PDB entry)
  8. 2285540Domain d5aohb_: 5aoh B: [328841]
    automated match to d2q17e_
    complexed with k

Details for d5aohb_

PDB Entry: 5aoh (more details), 1.8 Å

PDB Description: crystal structure of carf
PDB Compounds: (B:) carf

SCOPe Domain Sequences for d5aohb_:

Sequence, based on SEQRES records: (download)

>d5aohb_ d.169.1.0 (B:) automated matches {Serratia sp. [TaxId: 104623]}
ilpidevnvdggdfyvglvfgkedyaahanthltpfsimrtevtyhqyqalqawaetrgy
qisggcngatfedcwpsekdggrhpvtnvswwdavifanalsaqhnlqpyyvtadgqalk
ippeegtdrgirenpqasgyrlptlaewqvaarggnkglsdgtygsryagkdqpasvanl
pvsgtqtfstlpvaskqpnslglydmsgnvsewlnenyavkggkkmyyfcggsymdrvgs
lascdvhtpgfamsdigfrlvrpid

Sequence, based on observed residues (ATOM records): (download)

>d5aohb_ d.169.1.0 (B:) automated matches {Serratia sp. [TaxId: 104623]}
ilpidevnvdggdfyvglvfgkedyaahanthltpfsimrtevtyhqyqalqawaetrgy
qisggcngatfedcwpsekdggrhpvtnvswwdavifanalsaqhnlqpyyvtadgqalk
ippeegirenpqasgyrlptlaewqvaarggnkglsdgtygsryagkdqpasvanlpvsg
tqtfstlpvaskqpnslglydmsgnvsewlnenyavkggkkmyyfcggsymdrvgslasc
dvhtpgfamsdigfrlvrpid

SCOPe Domain Coordinates for d5aohb_:

Click to download the PDB-style file with coordinates for d5aohb_.
(The format of our PDB-style files is described here.)

Timeline for d5aohb_:

  • d5aohb_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-25