SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5fucv_ (5fuc V:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2017117Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2019634Protein automated matches [190119] (21 species)
    not a true protein
  7. 2019635Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (30 PDB entries)
  8. 2285539Domain d5fucv_: 5fuc V: [328840]
    Other proteins in same PDB: d5fuca1, d5fuca2, d5fucb_, d5fucc1, d5fucc2, d5fucd1, d5fucd2
    automated match to d4ocnf_
    complexed with nag

Details for d5fucv_

PDB Entry: 5fuc (more details), 2.7 Å

PDB Description: biophysical and cellular characterisation of a junctional epitope antibody that locks il-6 and gp80 together in a stable complex: implications for new therapeutic strategies
PDB Compounds: (V:) vhh6

SCOPe Domain Sequences for d5fucv_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fucv_ b.1.1.1 (V:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
dvqfvesgggsvhaggslrlncatsgyiystycmgwfrqapgkeregvahiytnsgrtyy
adsvkgrftisqdnakntvylqmnslkpedtaiyycaarpsircasfsateykdwgqgtq
vtvs

SCOPe Domain Coordinates for d5fucv_:

Click to download the PDB-style file with coordinates for d5fucv_.
(The format of our PDB-style files is described here.)

Timeline for d5fucv_:

  • d5fucv_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-25