Lineage for d1glpa2 (1glp A:1-78)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 180865Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
  4. 180866Superfamily c.47.1: Thioredoxin-like [52833] (12 families) (S)
  5. 181002Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (4 proteins)
  6. 181014Protein Glutathione S-transferase [52863] (27 species)
  7. 181201Species Mouse (Mus musculus), class pi [TaxId:10090] [52866] (6 PDB entries)
  8. 181204Domain d1glpa2: 1glp A:1-78 [32884]
    Other proteins in same PDB: d1glpa1, d1glpb1

Details for d1glpa2

PDB Entry: 1glp (more details), 1.9 Å

PDB Description: 1.8 angstroms molecular structure of mouse liver class pi glutathione s-transferase complexed with s-(p-nitrobenzyl)glutathione and other inhibitors

SCOP Domain Sequences for d1glpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1glpa2 c.47.1.5 (A:1-78) Glutathione S-transferase {Mouse (Mus musculus), class pi}
ppytivyfpvrgrceamrmlladqgqswkeevvtidtwmqgllkptclygqlpkfedgdl
tlyqsnailrhlgrslgl

SCOP Domain Coordinates for d1glpa2:

Click to download the PDB-style file with coordinates for d1glpa2.
(The format of our PDB-style files is described here.)

Timeline for d1glpa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1glpa1