SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5gmoa_ (5gmo A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (226 species)
    not a true protein
  7. 2285535Species Scheffersomyces stipitis [TaxId:322104] [328836] (1 PDB entry)
  8. 2285536Domain d5gmoa_: 5gmo A: [328837]
    automated match to d4pvca_

Details for d5gmoa_

PDB Entry: 5gmo (more details), 2.3 Å

PDB Description: x-ray structure of carbonyl reductase sscr
PDB Compounds: (A:) Protein induced by osmotic stress

SCOPe Domain Sequences for d5gmoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gmoa_ c.2.1.0 (A:) automated matches {Scheffersomyces stipitis [TaxId: 322104]}
mttsvfvsgatgylaqqiialvlskgykvvgsvrseekganlkklygddfsyevvkvleq
kgafdealkkhpevtiflhtaspvtfevedtekeilipaingtkyvlqsikdvapqitrv
vytssvvamsvpeelgspdvvlseaswsslsyeqskthgvlayfgskqfaeraawefveq
ekpnfalstvnpvyifgpqakdeevkgtlnlsaemvnsvlklnkdddvpattgtfidvrd
vakahlaafekdeakgerlllsntrfngqtlldvvrknfpqladklpvgkphsddfsafk
ewndkktkkilgfeyfdfetsvvdsikqvlk

SCOPe Domain Coordinates for d5gmoa_:

Click to download the PDB-style file with coordinates for d5gmoa_.
(The format of our PDB-style files is described here.)

Timeline for d5gmoa_:

  • d5gmoa_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-25