Lineage for d5fuce_ (5fuc E:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2017117Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2019634Protein automated matches [190119] (22 species)
    not a true protein
  7. 2019635Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (33 PDB entries)
  8. 2285530Domain d5fuce_: 5fuc E: [328831]
    Other proteins in same PDB: d5fuca1, d5fuca2, d5fucb_, d5fucc1, d5fucc2, d5fucd1, d5fucd2
    automated match to d4ocnf_
    complexed with nag

Details for d5fuce_

PDB Entry: 5fuc (more details), 2.7 Å

PDB Description: biophysical and cellular characterisation of a junctional epitope antibody that locks il-6 and gp80 together in a stable complex: implications for new therapeutic strategies
PDB Compounds: (E:) vhh6

SCOPe Domain Sequences for d5fuce_:

Sequence, based on SEQRES records: (download)

>d5fuce_ b.1.1.1 (E:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
qfvesgggsvhaggslrlncatsgyiystycmgwfrqapgkeregvahiytnsgrtyyad
svkgrftisqdnakntvylqmnslkpedtaiyycaarpsircasfsateykdwgqgtq

Sequence, based on observed residues (ATOM records): (download)

>d5fuce_ b.1.1.1 (E:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
qfvesgslrlncatsgyiystycmgwfrqapgkeregvahiytnsgrtyyadsvkgrfti
sqdnakntvylqmnslkpedtaiyycaarpsircasfsateykdwgqgtq

SCOPe Domain Coordinates for d5fuce_:

Click to download the PDB-style file with coordinates for d5fuce_.
(The format of our PDB-style files is described here.)

Timeline for d5fuce_:

  • d5fuce_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-25