SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5fuce_ (5fuc E:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2017117Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2019634Protein automated matches [190119] (22 species)
    not a true protein
  7. 2019635Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (30 PDB entries)
  8. 2285530Domain d5fuce_: 5fuc E: [328831]
    Other proteins in same PDB: d5fuca1, d5fuca2, d5fucb_, d5fucc1, d5fucc2, d5fucd1, d5fucd2
    automated match to d4ocnf_
    complexed with nag

Details for d5fuce_

PDB Entry: 5fuc (more details), 2.7 Å

PDB Description: biophysical and cellular characterisation of a junctional epitope antibody that locks il-6 and gp80 together in a stable complex: implications for new therapeutic strategies
PDB Compounds: (E:) vhh6

SCOPe Domain Sequences for d5fuce_:

Sequence, based on SEQRES records: (download)

>d5fuce_ b.1.1.1 (E:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
qfvesgggsvhaggslrlncatsgyiystycmgwfrqapgkeregvahiytnsgrtyyad
svkgrftisqdnakntvylqmnslkpedtaiyycaarpsircasfsateykdwgqgtq

Sequence, based on observed residues (ATOM records): (download)

>d5fuce_ b.1.1.1 (E:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
qfvesgslrlncatsgyiystycmgwfrqapgkeregvahiytnsgrtyyadsvkgrfti
sqdnakntvylqmnslkpedtaiyycaarpsircasfsateykdwgqgtq

SCOPe Domain Coordinates for d5fuce_:

Click to download the PDB-style file with coordinates for d5fuce_.
(The format of our PDB-style files is described here.)

Timeline for d5fuce_:

  • d5fuce_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-25