Lineage for d5ghxb_ (5ghx B:)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2217740Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2217741Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2217742Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 protein domains)
  6. 2218486Protein automated matches [190161] (23 species)
    not a true protein
  7. 2218489Species Bacillus licheniformis [TaxId:1402] [188244] (15 PDB entries)
  8. 2285529Domain d5ghxb_: 5ghx B: [328830]
    automated match to d2blma_
    complexed with acy, edo; mutant

Details for d5ghxb_

PDB Entry: 5ghx (more details), 1.24 Å

PDB Description: crystal structure of beta-lactamase penp mutant-e166h
PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d5ghxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ghxb_ e.3.1.1 (B:) automated matches {Bacillus licheniformis [TaxId: 1402]}
ddfakleeqfdaklgifaldtgtnrtvayrpderfafastikaltvgvllqqksiedlnq
ritytrddlvnynpitekhvdtgmtlkeladaslrysdnaaqnlilkqiggpeslkkelr
kigdevtnperfhpelnevnpgetqdtstaralvtslrafaledklpsekrellidwmkr
nttgdaliragvpdgwevadktgaasygtrndiaiiwppkgdpvvlavlssrdkkdakyd
dkliaeatkvvmkaln

SCOPe Domain Coordinates for d5ghxb_:

Click to download the PDB-style file with coordinates for d5ghxb_.
(The format of our PDB-style files is described here.)

Timeline for d5ghxb_:

  • d5ghxb_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-25