SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ghxb_ (5ghx B:)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2217740Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2217741Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2217742Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 protein domains)
  6. 2218486Protein automated matches [190161] (23 species)
    not a true protein
  7. 2218489Species Bacillus licheniformis [TaxId:1402] [188244] (14 PDB entries)
  8. 2285529Domain d5ghxb_: 5ghx B: [328830]
    automated match to d2blma_
    complexed with acy, edo; mutant

Details for d5ghxb_

PDB Entry: 5ghx (more details), 1.24 Å

PDB Description: crystal structure of beta-lactamase penp mutant-e166h
PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d5ghxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ghxb_ e.3.1.1 (B:) automated matches {Bacillus licheniformis [TaxId: 1402]}
ddfakleeqfdaklgifaldtgtnrtvayrpderfafastikaltvgvllqqksiedlnq
ritytrddlvnynpitekhvdtgmtlkeladaslrysdnaaqnlilkqiggpeslkkelr
kigdevtnperfhpelnevnpgetqdtstaralvtslrafaledklpsekrellidwmkr
nttgdaliragvpdgwevadktgaasygtrndiaiiwppkgdpvvlavlssrdkkdakyd
dkliaeatkvvmkaln

SCOPe Domain Coordinates for d5ghxb_:

Click to download the PDB-style file with coordinates for d5ghxb_.
(The format of our PDB-style files is described here.)

Timeline for d5ghxb_:

  • d5ghxb_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-25