Lineage for d5fucd2 (5fuc D:196-298)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2029371Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2029372Family b.1.2.1: Fibronectin type III [49266] (45 protein domains)
    Pfam PF00041
  6. 2029834Protein automated matches [190888] (1 species)
    not a true protein
  7. 2029835Species Human (Homo sapiens) [TaxId:9606] [188282] (30 PDB entries)
  8. 2285528Domain d5fucd2: 5fuc D:196-298 [328829]
    Other proteins in same PDB: d5fuca1, d5fuca2, d5fucb_, d5fuce_, d5fucv_
    automated match to d1n26a3
    complexed with nag

Details for d5fucd2

PDB Entry: 5fuc (more details), 2.7 Å

PDB Description: biophysical and cellular characterisation of a junctional epitope antibody that locks il-6 and gp80 together in a stable complex: implications for new therapeutic strategies
PDB Compounds: (D:) interleukin-6 receptor subunit alpha, interleukin-6 receptor

SCOPe Domain Sequences for d5fucd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fucd2 b.1.2.1 (D:196-298) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpdppanitvtavarnprwlsvtwqdphswnssfyrlrfelryraersktfttwmvkdlq
hhavihdawsglrhvvqlraqeefgqgewsewspeamgtpwte

SCOPe Domain Coordinates for d5fucd2:

Click to download the PDB-style file with coordinates for d5fucd2.
(The format of our PDB-style files is described here.)

Timeline for d5fucd2:

  • d5fucd2 appears in periodic updates to SCOPe 2.06 starting on 2017-01-25