SCOPe 2.06: Domain d5fucd1: 5fuc D:94-195

Lineage for d5fucd1 (5fuc D:94-195)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein automated matches [190888] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188282] (30 PDB entries)

8. Domain d5fucd1: 5fuc D:94-195 [328828]
   Other proteins in same PDB: d5fuca1, d5fuca2, d5fucb_, d5fuce_, d5fucv_
   automated match to d1n26a2
   complexed with nag

Details for d5fucd1

PDB Entry: 5fuc, 2.7 Å

PDB Description: biophysical and cellular characterisation of a junctional epitope antibody that locks il-6 and gp80 together in a stable complex: implications for new therapeutic strategies

PDB Compounds: (D:) interleukin-6 receptor subunit alpha, interleukin-6 receptor

SCOPe Domain Sequences for d5fucd1:

Sequence, based on SEQRES records:

>d5fucd1 b.1.2.1 (D:94-195) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ppeepqlscfrksplsnvvcewgprstpslttkavllvrkfqnspaedfqepcqysqesq
kfscqlavpegdssfyivsmcvassvgskfsktqtfqgagil

Sequence, based on observed residues (ATOM records):

>d5fucd1 b.1.2.1 (D:94-195) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ppeepqlscfrksplsnvvcewgprstpslttkavllvrkdfqepcqysqesqkfscqla
vpegdssfyivsmcvassvgskfsktqtfqgagil

Timeline for d5fucd1:

• d5fucd1 is new in SCOPe 2.06-stable
  
• d5fucd1 appears in SCOPe 2.07
  
• d5fucd1 appears in the current release, SCOPe 2.08