![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds) |
![]() | Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
![]() | Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) ![]() |
![]() | Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 protein domains) |
![]() | Protein automated matches [190161] (23 species) not a true protein |
![]() | Species Bacillus licheniformis [TaxId:1402] [188244] (15 PDB entries) |
![]() | Domain d5ghzb_: 5ghz B: [328823] automated match to d2blma_ complexed with ced; mutant |
PDB Entry: 5ghz (more details), 1.93 Å
SCOPe Domain Sequences for d5ghzb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ghzb_ e.3.1.1 (B:) automated matches {Bacillus licheniformis [TaxId: 1402]} ddfakleeqfdaklgifaldtgtnrtvayrpderfafastikaltvgvllqqksiedlnq ritytrddlvnynpitekhvdtgmtlkeladaslrysdnaaqnlilkqiggpeslkkelr kigdevtnperfhpelnevnpgetqdtstaralvtslrafaledklpsekrellidwmkr nttgdaliragvpdgwevadktgaasygtrndiaiiwppkgdpvvlavlssrdkkdakyd dkliaeatkvvmkaln
Timeline for d5ghzb_: