SCOPe Funding Alert: SCOPe support from the NIH
ended in April 2016. John-Marc Chandonia is the primary
maintainer and has continued to develop SCOPe using vacation
time. Three proposals to the NIH for continued funding have been
unsuccessful. If our current NIH proposal is not funded,
SCOPe will shut down permanently in Summer 2017
as Dr. Chandonia will need to seek a new position.
Lineage for d5ghzb_ (5ghz B:)
- Root: SCOPe 2.06
Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds) Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
contains a cluster of helices and an alpha+beta sandwichSuperfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) 
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 protein domains) Protein automated matches [190161] (23 species)
not a true protein
Species Bacillus licheniformis [TaxId:1402] [188244] (14 PDB entries) 
Domain d5ghzb_: 5ghz B: [328823]
automated match to d2blma_
complexed with ced; mutant
Details for d5ghzb_
PDB Entry: 5ghz (more details), 1.93 Å
PDB Description: crystal structure of beta-lactamase penp mutant-e166h in complex with cephaloridine as "pre-deacylation" intermediate
PDB Compounds: (B:) Beta-lactamaseSCOPe Domain Sequences for d5ghzb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ghzb_ e.3.1.1 (B:) automated matches {Bacillus licheniformis [TaxId: 1402]}
ddfakleeqfdaklgifaldtgtnrtvayrpderfafastikaltvgvllqqksiedlnq
ritytrddlvnynpitekhvdtgmtlkeladaslrysdnaaqnlilkqiggpeslkkelr
kigdevtnperfhpelnevnpgetqdtstaralvtslrafaledklpsekrellidwmkr
nttgdaliragvpdgwevadktgaasygtrndiaiiwppkgdpvvlavlssrdkkdakyd
dkliaeatkvvmkaln
SCOPe Domain Coordinates for d5ghzb_:
Click to download the PDB-style file with coordinates for d5ghzb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5ghzb_:
- d5ghzb_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-25
View in 3D
