SCOPe 2.07: Domain d5ghzb_: 5ghz B:

Lineage for d5ghzb_ (5ghz B:)

1. Root: SCOPe 2.07

2. Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 protein domains)

6. Protein automated matches [190161] (23 species)
   not a true protein

7. Species Bacillus licheniformis [TaxId:1402] [188244] (15 PDB entries)

8. Domain d5ghzb_: 5ghz B: [328823]
   automated match to d2blma_
   complexed with ced; mutant

Details for d5ghzb_

PDB Entry: 5ghz, 1.93 Å

PDB Description: crystal structure of beta-lactamase penp mutant-e166h in complex with cephaloridine as "pre-deacylation" intermediate

PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d5ghzb_:

Sequence; same for both SEQRES and ATOM records:

>d5ghzb_ e.3.1.1 (B:) automated matches {Bacillus licheniformis [TaxId: 1402]}
ddfakleeqfdaklgifaldtgtnrtvayrpderfafastikaltvgvllqqksiedlnq
ritytrddlvnynpitekhvdtgmtlkeladaslrysdnaaqnlilkqiggpeslkkelr
kigdevtnperfhpelnevnpgetqdtstaralvtslrafaledklpsekrellidwmkr
nttgdaliragvpdgwevadktgaasygtrndiaiiwppkgdpvvlavlssrdkkdakyd
dkliaeatkvvmkaln

Timeline for d5ghzb_:

• d5ghzb_ first appeared in SCOPe 2.06