Lineage for d5ffga2 (5ffg A:440-594)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2038467Superfamily b.1.15: Integrin domains [69179] (2 families) (S)
  5. 2038496Family b.1.15.0: automated matches [233856] (1 protein)
    not a true family
  6. 2038497Protein automated matches [233857] (1 species)
    not a true protein
  7. 2038498Species Human (Homo sapiens) [TaxId:9606] [233858] (12 PDB entries)
  8. 2038502Domain d5ffga2: 5ffg A:440-594 [328820]
    Other proteins in same PDB: d5ffga1
    automated match to d1m1xa1
    complexed with bma, ca, man, mes, nag, peg, so4

Details for d5ffga2

PDB Entry: 5ffg (more details), 2.25 Å

PDB Description: crystal structure of integrin alpha v beta 6 head
PDB Compounds: (A:) Integrin alpha-V

SCOPe Domain Sequences for d5ffga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ffga2 b.1.15.0 (A:440-594) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvitvnaglevypsilnqdnktcslpgtalkvscfnvrfclkadgkgvlprklnfqvell
ldklkqkgairralflysrspshsknmtisrgglmqceeliaylrdesefrdkltpitif
meyrldyrtaadttglqpilnqftpanisrqahil

SCOPe Domain Coordinates for d5ffga2:

Click to download the PDB-style file with coordinates for d5ffga2.
(The format of our PDB-style files is described here.)

Timeline for d5ffga2: